CCL14 (C-C Motif Chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible Cytokine A14, NCC2, SCYA14)

Größe

£760.00

SKU:: 124443
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human CCL14, aa1-93 (NP_004157).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CCL14 is member of a superfamily of inducible, secreted, proinflammatory cytokines. It has weak activities on human monocytes and acts via receptors that also recognize MIP-1alpha. It also enhances the proliferation of CD34 myeloid progenitor cells. The processed form of CCL14, designated HCC-1(9-74), is a chemotactic factor that attracts monocytes, eosinophils and T cells and is a ligand for CCR1, CCR3 and CCR5. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.