CBLL1 (HAKAI, E3 Ubiquitin-protein Ligase Hakai, Casitas B-lineage Lymphoma-transforming Sequence-like Protein 1, RING Finger Protein 188, c-Cbl-like Protein 1, RNF188)

Größe

£685.00

SKU:: 124388
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from human CBLL1 (NP_079090) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Promotes ubiquitination of several tyrosine-phosphorylated Src substrates, including CDH1, CTTN and DOK1. Targets CDH1 for endocytosis and degradation. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.