124353-PE
CASP10 (Caspase-10, CASP-10, ICE-like Apoptotic Protease 4, Apoptotic Protease Mch-4, FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2, FLICE2, Caspase-10 Subunit p23/17, Caspase-10 Subunit p12, MCH4) (PE)
Größe
£914.00
- SKU:
- 124353-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-110 from human CASP10 (NP_116756) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- Caspases are death effector domain-containing cysteine aspartases presumed to be at or near the apex of apoptotic signaling pathways. All known isoforms of Caspase-10 are abundantly expressed in fetal lung, kidney, and skeletal muscle but are very poorly expressed or absent in these tissues in the adult, implying a possible role for the Caspase-10 family in fetal development. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice