CARD17 (Caspase Recruitment Domain Family, Member 17, INCA, Inhibitory Caspase Recruitment Domain Protein)

Größe

£685.00

SKU:: 124340
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-110 from human CARD17 (NP_001007233) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.