CARD14 (Caspase Recruitment Domain-containing Protein 14, CARD-containing MAGUK Protein 2, Carma 2, CARMA2)

Größe

£685.00

SKU:: 124339
Reinheit:: Purified by Protein A affinity chromatography
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa905-1005 from human CARD14 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B3
Format:: Supplied as a liquid in PBS, pH 7.4
Weitere Details:: CARD (caspase recruitment domain) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. CARD belongs to the membrane-associated guanylate kinase (MAGUK) family and activates nuclear factor-Kappa-B through BCL10. The family members show differences in tissue expression. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDLDRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.