CAPNS1 (Calpain Small Subunit 1, CSS1, Calcium-activated Neutral Proteinase Small Subunit, CANP Small Subunit, Calcium-dependent Protease Small Subunit, CDPS, Calcium-dependent Protease Small Subunit 1, Calpain Regulatory Subunit, CAPN4, CAPNS)

Größe

£685.00

SKU:: 124328
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein fragment corresponding to aa172-260 of human CAPNS1 (BC000592; AAH00592) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Regulatory subunit of the calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence: 20ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence of Immunogen: KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.