CAPN9 (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4)

Größe

£685.00

SKU:: 124326
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa591-690 from human CAPN9 (NP_006606) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CAPN9 has been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This protein is thought to be associated with gastric cancer. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.