124326-HRP
CAPN9 (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (HRP)
Größe
£914.00
- SKU:
- 124326-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa591-690 from human CAPN9 (NP_006606) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- CAPN9 has been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This protein is thought to be associated with gastric cancer. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice