124323-BIOTIN

CAPN3 (Calpain-3, Calpain L3, Calpain p94, Calcium-activated Neutral Proteinase 3, CANP 3, Muscle-specific Calcium-activated Neutral Protease 3, New Calpain 1, nCL-1, NCL1, CANPL3, CANP3) (Biotin)

Größe

£927.00

SKU:: 124323-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa210-309 from human CAPN3 (AAH03169.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: CAPN3, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. The protein is a muscle-specific member of the calpain large subunit family that specifically binds to titin. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.