124323-APC

CAPN3 (Calpain-3, Calpain L3, Calpain p94, Calcium-activated Neutral Proteinase 3, CANP 3, Muscle-specific Calcium-activated Neutral Protease 3, New Calpain 1, nCL-1, NCL1, CANPL3, CANP3) (APC)

Größe

£927.00

SKU:: 124323-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa210-309 from human CAPN3 (AAH03169.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B2
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: CAPN3, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. The protein is a muscle-specific member of the calpain large subunit family that specifically binds to titin. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.