CANT1 (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY)

Größe

£685.00

SKU:: 124311
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa302-401 from human CANT1 (AAH17655) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CANT1 belongs to the apyrase family. It functions as a calcium-dependent nucleotidase with a preference for UDP. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ASQERYSEKDDERKGANLLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVKYEGIEFI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.