124308-PE

TIP120A (Cullin-associated NEDD8-dissociated Protein 1, Cullin-associated And Neddylation-dissociated Protein 1, p120 CAND1, TBP-interacting Protein TIP120A, TBP-interacting Protein of 120kD A, TIP120, KIAA0829, CAND1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441) (PE)

Größe

£914.00

SKU:: 124308-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from human CAND1 (NP_060918) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5D7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: TIP120A enhances transcription from various types of promoters. It is regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. It prevents neddylation of CUL1 by physically blocking access to the neddylation site and disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice