124308-BIOTIN
TIP120A (Cullin-associated NEDD8-dissociated Protein 1, Cullin-associated And Neddylation-dissociated Protein 1, p120 CAND1, TBP-interacting Protein TIP120A, TBP-interacting Protein of 120kD A, TIP120, KIAA0829, CAND1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441) (Biotin)
Größe
£927.00
- SKU:
- 124308-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-101 from human CAND1 (NP_060918) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5D7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- TIP120A enhances transcription from various types of promoters. It is regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. It prevents neddylation of CUL1 by physically blocking access to the neddylation site and disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice