CAMKK2 (Calcium/Calmodulin-dependent Protein Kinase Kinase 2, CaM-kinase Kinase 2, CaM-KK 2, CaMKK 2, Calcium/Calmodulin-dependent Protein Kinase Kinase beta, CaM-kinase Kinase beta, CaM-KK beta, CaMKK beta, CAMKKB, KIAA0787)

Größe

£685.00

SKU:: 124301
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-130 from CAMKK2 (AAH26060) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CAMKK2 belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 appears to be involved in hippocampal activation of CREB1. Applications: Suitable for use in Western Blot, ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice