124286-FITC
CAMK2A (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit alpha, CaM-kinase II Subunit alpha, CaM Kinase II Subunit alpha, CAMKA, KIAA0968) (FITC)
Größe
£914.00
- SKU:
- 124286-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa305-410 from human CAMK2A (AAH40457) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2C4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- CaMKII is a member of calcium/calmodulin-activated kinase, functioning in neural synaptic stimulation and T-cell receptor signaling. CaMKII has catalytic and regulatory domains. The binding of Ca++/calmodulin to its regulatory domain releases its autoinhibitory effect and activates the kinase. The activated CaMKII further autophosphorylates itself at Thr286 to render the kinase constitutively active. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice