124286-BIOTIN
CAMK2A (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit alpha, CaM-kinase II Subunit alpha, CaM Kinase II Subunit alpha, CAMKA, KIAA0968) (Biotin)
Größe
£927.00
- SKU:
- 124286-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa305-410 from human CAMK2A (AAH40457) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2C4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- CaMKII is a member of calcium/calmodulin-activated kinase, functioning in neural synaptic stimulation and T-cell receptor signaling. CaMKII has catalytic and regulatory domains. The binding of Ca++/calmodulin to its regulatory domain releases its autoinhibitory effect and activates the kinase. The activated CaMKII further autophosphorylates itself at Thr286 to render the kinase constitutively active. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice