Cadherin N (Neural Cadherin, N-Cadherin, CDHN, NCAD, Cadherin 2 Type 1 N-Cadherin (Neuronal), Cadherin-2, CDH2, CD325, CD325 Antigen, CDw325)

Größe

£685.00

SKU:: 124234
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa807-906 from human CDH2 (NP_001783) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5C8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Cadherin-2 or Neural Cadherin is a member of the cadherin family of proteins that mediate calcium ion-dependent cell adhesion. Other members include E-cadherin and P-cadherin. Cadherin-2 is expressed in the brain and skeletal and cardiac muscle. Cadherin-2 has been identified as a potential prognostic marker for a number of tumors. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.