124234-BIOTIN
Cadherin N (Neural Cadherin, N-Cadherin, CDHN, NCAD, Cadherin 2 Type 1 N-Cadherin (Neuronal), Cadherin-2, CDH2, CD325, CD325 Antigen, CDw325) (Biotin)
Größe
£927.00
- SKU:
- 124234-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa807-906 from human CDH2 (NP_001783) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5C8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Cadherin-2 or Neural Cadherin is a member of the cadherin family of proteins that mediate calcium ion-dependent cell adhesion. Other members include E-cadherin and P-cadherin. Cadherin-2 is expressed in the brain and skeletal and cardiac muscle. Cadherin-2 has been identified as a potential prognostic marker for a number of tumors. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice