124179
CA11 (Carbonic Anhydrase-related Protein 11, CA-RP XI, CARP XI, CA-XI, Carbonic Anhydrase-related Protein 2, CARP-2, CA-RP II, UNQ211/PRO237, CARP2)
Größe
£685.00
- SKU:
- 124179
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human CA11, aa1-328 (NP_001208.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- CA11 belongs a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. CA11 is likely a secreted protein, however, radical changes at active site residues completely conserved in CA isozymes with catalytic activity, make it unlikely that it has carbonic anhydrase activity. This protein shares properties in common with two other acatalytic CA isoforms, CA VIII and CA X. The protein is most abundantly expressed in brain, and may play a general role in the central nervous system. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice