C6orf199 (AKD1, AKD2, C6orf199, C6orf224, Adenylate Kinase Domain-containing Protein 1, Adenylate Kinase Domain-containing Protein 2, FLJ42177, MGC26954, RP1-70A9.1, DJ70A9.1)

Größe

£685.00

SKU:: 124148
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa321-422 from human C6orf199 (NP_659462) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The function of C6ORF199 remains unknown. There are 3 isoforms produced by alternative splicing; isoform 1 is 751aa in length (87kD), isoform 2 is 421aa (49kD) and isoform 3 is 1014aa (117kD). Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.