124148-FITC
C6orf199 (AKD1, AKD2, C6orf199, C6orf224, Adenylate Kinase Domain-containing Protein 1, Adenylate Kinase Domain-containing Protein 2, FLJ42177, MGC26954, RP1-70A9.1, DJ70A9.1) (FITC)
Größe
£914.00
- SKU:
- 124148-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa321-422 from human C6orf199 (NP_659462) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1H8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- The function of C6ORF199 remains unknown. There are 3 isoforms produced by alternative splicing; isoform 1 is 751aa in length (87kD), isoform 2 is 421aa (49kD) and isoform 3 is 1014aa (117kD). Applications: Suitable for use in FLISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice