124148-BIOTIN

C6orf199 (AKD1, AKD2, C6orf199, C6orf224, Adenylate Kinase Domain-containing Protein 1, Adenylate Kinase Domain-containing Protein 2, FLJ42177, MGC26954, RP1-70A9.1, DJ70A9.1) (Biotin)

Größe

£927.00

SKU:: 124148-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa321-422 from human C6orf199 (NP_659462) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: The function of C6ORF199 remains unknown. There are 3 isoforms produced by alternative splicing; isoform 1 is 751aa in length (87kD), isoform 2 is 421aa (49kD) and isoform 3 is 1014aa (117kD). Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.