124148-APC

C6orf199 (AKD1, AKD2, C6orf199, C6orf224, Adenylate Kinase Domain-containing Protein 1, Adenylate Kinase Domain-containing Protein 2, FLJ42177, MGC26954, RP1-70A9.1, DJ70A9.1) (APC)

Größe

£927.00

SKU:: 124148-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa321-422 from human C6orf199 (NP_659462) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H8
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: The function of C6ORF199 remains unknown. There are 3 isoforms produced by alternative splicing; isoform 1 is 751aa in length (87kD), isoform 2 is 421aa (49kD) and isoform 3 is 1014aa (117kD). Applications: Suitable for use in FLISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.