124131
C3aR (C3a Anaphylatoxin Chemotactic Receptor, C3a-R, C3AR1, AZ3B, C3R1, HNFAG09)
Größe
£760.00
- SKU:
- 124131
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length protein corresponding to aa1-482 from human C3AR1.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- C3a is an anaphylatoxin generated through activation of the complement C3. C3a is a potent chemoattractant for phagocytes, and it stimulates chemotaxis and other leukocyte functions. C3a binds to eosinophils, basophils, neutrophils, and differentiated U937 cells, that all express receptors for C3a on their cell surface. The C3a receptor has been cloned and shown to be a G protein-coupled receptor with seven putative transmembrane domains. This receptor is characterized for its large extracellular loop between the fourth and fifth transmembrane domains. The loop can be readily detected using the rabbit anti-C3a receptor antibody. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice