124091
C1orf19 (Chromosome 1 Open Reading Frame 19, tRNA-splicing Endonuclease Subunit Sen15, SEN15 Homolog, HsSEN15, tRNA-intron Endonuclease Sen15, TSEN15, SEN15)
Größe
£685.00
- SKU:
- 124091
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa72-171 from human C1orf19 (NP_443197) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 8C7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- tRNA splicing is a fundamental process required for cell growth and division. SEN15 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]). Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice