C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1, B3Gal-T8, Core 1 O-glycan T-synthase, Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1, Beta-1,3-galactosyltransferase, Core 1 beta1,3-galactosyltransferase 1, C1GalT1, Core 1 beta3-Gal-T1)

Größe

£685.00

SKU:: 124087
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa264-364 from human C1GALT1 (NP_064541) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.