124086-PE
C1D (MGC12261, MGC14659, SUNCOR, C1D DNA-binding Protein, Small Unique Nuclear Receptor Corepressor, Nuclear DNA-binding Protein) (PE)
Größe
£914.00
- SKU:
- 124086-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-141 from C1D (AAH05235) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6H2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- C1D is known as nuclear nucleic acid-binding protein C1D. C1D is a ubiquitously expressed nuclear matrix DNA-binding, and apoptosis-inducing protein, which acts as an activator of the DNA-dependent protein kinase (DNA-PK), and is implicated as a regulator of TRAX/Translin complex formation. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice