RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929)

Größe

£685.00

SKU:: 124077
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2016-2113 from human C17orf27 (NP_065965) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Probable E3 ubiquitin-protein ligase that may play a role in angiogenesis. May also have an ATPase activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.