BTN2A1 (Butyrophilin Subfamily 2 Member A1, BT2.1, BTF1)

Größe

£685.00

SKU:: 124046
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-334 from human BTN2A1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The MHC-encoded butyrophilin, BTN2A1, is a cell surface glycoprotein related to the extended family of B7 costimulatory molecules. BTN2A1 mRNA is expressed in most human tissues, but protein expression is significantly lower in leukocytes. The protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism. Recent studies reveal that the protein can negatively regulate T cell proliferation and cytokine production. Additionally, genetic studies have described polymorphisms in the protein which are reported to be associated with disorders such as sarcoidosis, myositis andulcerative colitis. Human BTN2A1 gene is located in 6p22.1. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice