BTLA (B- and T-lymphocyte Associated Protein, B- and T-lymphocyte Attenuator, BTLA1, CD272, CD272 Antigen, FLJ16065, MGC129743)

Größe

£685.00

SKU:: 124044
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa190-290 from human BTLA (NP_861445) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Human CD272 (BTLA, B and T Lymphocyte Attenuator) is a member of the Immunoglobulin superfamily and has homology to CD152 (CTLA-4). Engagement of BTLA by its co receptor CD270 (HVEM, a TNF superfamily member) can down regulate activated T and B cell responses. BTLA levels on antigen specific CD8+ T cells have been reported to decrease in viral specific, but not melanoma specific activated lines. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.