BSND (Barttin, Bartter Syndrome, Infantile, with Sensorineural Deafness, BART, DFNB73, MGC119283, MGC119284, MGC119285)

Größe

£685.00

SKU:: 124023
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa221-320 from human BSND with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E8
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: BSND encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Applications: Suitable for use in ELISA and Western Blot. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amini Acid Sequence: ACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.