123974-ML650
BNIP3L (BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3-like, Adenovirus E1B19K-Binding Protein B5, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3A, NIP3-like Protein X, NIP3L, BNIP3A, BNIP3H, NIX) (MaxLight 650)
Größe
£914.00
- SKU:
- 123974-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa43-130 from human BNIP3L (NP_004322) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Bcl-2/adenovirus E1B 19kD protein-interacting protein 3-like (BNIP3L) also known as BNIP3 alpha and NIP3-like protein X (Nix), is a proapoptotic member of BNIP3 protein family. BNIP3L is a functional homolog of BNIP3 and both proteins contain a single Bcl-2 homology 3 (BH3) domain. BNIP3L is a 219aa, 24kD (predicted) protein that contains a C-terminal transmembrane domain required for mitochondrial localization, homodimerisation, and regulation of its proapoptotic function. BNIP3L may antagonize the activity of BCL2 family antiapoptic proteins by directly interactacting with proteins such as viral E1B-19K and cellular Bcl-2 and Bcl-xL. BNIP3L shares 56% aa sequence identity with BNIP3 and 98% with mouse and rat BNIP3L. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice