123968-BIOTIN
BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X Protein, ETK, Epithelial and Endothelial Tyrosine Kinase, NTK38) (Biotin)
Größe
£927.00
- SKU:
- 123968-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa150-280 from human BMX (AAH16652) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Etk is a member of the Bruton's tyrosine kinase family. Etk is expressed in a variety of hematopoietic, epithelial and endothelial cells. It participates in multiple signal transduction pathways. Phosphorylation of tyrosine 566 by Src kinase is required for activation of Etk in vivo. In endothelial and epithelial cells, Etk is regulated by FAK through phosphorylation at tyrosine 40. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice