BMP9 (Growth/Differentiation Factor 2, GDF-2, Bone Morphogenetic Protein 9, BMP-9, GDF2)

Größe

£685.00

SKU:: 123963
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa320-419 from human BMP9 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons. Applications: Suitable for use in ELISA. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.