123950
BLVRA (Biliverdin Reductase A, BVR A, Biliverdin-IX alpha-reductase, BLVR, BVR)
Größe
£685.00
- SKU:
- 123950
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-296 from human BLVRA (AAH08456) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4G4-2B6
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- BLVRA, also known as biliverdin reductase A, belongs to the gfo/idh/mocA family. This protein is an enzyme that converts biliverdin to bilirubin, converting a double-bond between the second and third pyrrole ring into a single-bond.( Bilirubin + NAD(P)+ = biliverdin + NAD(P)H ) Recombinant BLVRA protein , expressed in E. coli and purified by using conventional chromatography techniques. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice