BLM (Bloom Syndrome Protein, RecQ Protein-like 3, DNA Helicase, RecQ-like Type 2, RECQL3, RECQ2)

Größe

£685.00

SKU:: 123943
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1196-1295 from human BLM (NP_000048) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: BLM participates in DNA replication and repair and Exhibits a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single-and double-stranded DNA in a 3'-5' direction. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.