123936
BIN1 (Myc Box-dependent-interacting Protein 1, Amphiphysin II, Amphiphysin-like Protein, Box-dependent Myc-interacting Protein 1, Bridging Integrator 1, AMPHL)
Größe
£685.00
- SKU:
- 123936
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa355-454 from human BIN1 (NP_004296) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1H1
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Box-dependent myc interacting protein 1 (BIN1) interacts with and inhibits the oncogenic activity of the myc oncoprotein and thus may act as a tumor suppressor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice