123934-PE
BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (PE)
Größe
£914.00
- SKU:
- 123934-PE
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-100 from human BIM with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2F10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- Bim belongs to Bcl-2 family of proteins containing Bcl-2 homology domain3 (BH3). It is proapoptotic and exerts its effects by interacting with prosurvival members of the Bcl-2 family like Bcl-2, Bcl-XL and Bcl-w. It exhibits three splice variants; BimL, BimS and BimEL. They all share homology in their C-terminal BH3 domain and are ubiquitously expressed. BimS is the strongest of them with respect to the proapoptotic capacity. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice