123926-ML550
BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hairy-related Protein 1, SHARP-1, DEC2, SHARP1) (MaxLight 550)
Größe
£914.00
- SKU:
- 123926-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa203-283 from human BHLHB3 (NP_110389) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4H6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. BHLHE41 may be a transcriptional repressor that represses both basal and activated transcription. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice