BHLHE40 (BHLHB2, Class E Basic Helix-loop-helix Protein 40, bHLHe40, Class B Basic Helix-loop-helix Protein 2, bHLHb2, Differentially Expressed in Chondrocytes Protein 1, DEC1, Enhancer-of-split and Hairy-related Protein 2, SHARP-2, Stimulated by Retinoic Acid Gene 13 Protein, DEC1, SHARP2, STRA13, FLJ99214)

Größe

£685.00

SKU:: 123925
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa130-229 from human BHLHE40 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5B1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May function as a transcriptional factor to modulate chondrogenesis in response to the cAMP pathway. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.