123906
BD-4 (Beta-defensin 104, Beta-defensin 4, DEFB104A, DEFB-4, hBD-4, Defensin, beta 104, DEFB104, DEFB4, DEFB104B)
Größe
£685.00
- SKU:
- 123906
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa24-64 from human DEFB4 (NP_004933) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4C4
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice