123883-FITC
BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-B, BCLB) (FITC)
Größe
£934.00
- SKU:
- 123883-FITC
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human BCL2L10, aa1-204 (NP_065129.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- Bcl-B (also called Bcl2-L-10) is a novel anti-apoptotic member of the Bcl-2 family. Bcl-B is closest in aa sequence homology to Boo protein. It contains four Bcl-2 homologs. Bcl-B mRNA is widely expressed in adult human tissues. The Bcl-B protein binds to Bcl-2, Bcl-X(L), and Bax but not Bak. Bcl-B suppresses apoptosis induced by Bax, but not by Bak. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice