BCL11A (CTIP1, EVI9, KIAA1809, ZNF856, B Cell Lymphoma/Leukemia 11A, B Cell CLL/Lymphoma 11A, COUP-TF-interacting Protein 1, Ecotropic Viral Integration Site 9 Protein Homolog, Zinc Finger Protein 856, FLJ10173, FLJ34997, HBFQTL5)

Größe

£685.00

SKU:: 123880
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-89 from human BCL11A (NP_060484) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: BCL11A is a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.