123868
BCAS1 (Breast Carcinoma-amplified Sequence 1, Amplified and Overexpressed in Breast Cancer, Novel Amplified in Breast Cancer 1, AIBC1, NABC1)
Größe
£685.00
- SKU:
- 123868
- Reinheit:
- Purified by Protein A affinity chromatography
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-80 from human BCAS1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B5
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Weitere Details:
- This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 1.5ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice