123862
BCAP31 (B Cell Receptor-associated Protein 31, BCR-associated Protein 31, Bap31, 6C6-AG Tumor-associated Antigen, Protein CDM, p28, BAP31, DXS1357E)
Größe
£685.00
- SKU:
- 123862
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length human BCAP31, aa1-246 (NP_005736.3).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- BAP31 appears to be a multi-functional ER-associated transport protein which was originally identified through its association with membrane IgD in B lymphocytes. Several proteins have since been shown to associate with BAP31, including the Beta2 integrin receptor CD11b/CD18, and nonmuscle gamma-actin and myosin B heavy chain. BAP31 has become a focus area for apoptosis studies due to its association with Bcl-2 and cleavage by initiator caspases including caspase 1 and 8. Cleavage of BAP31 generates a membrane-integrated p20 fragment which is itself a potent inducer of apoptosis when expressed ectopically. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice