BBOX1 (Gamma-butyrobetaine Dioxygenase, Gamma-butyrobetaine Hydroxylase, Gamma-BBH, Gamma-butyrobetaine,2-oxoglutarate Dioxygenase, BBH, BBOX)

Größe

£685.00

SKU:: 123847
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa278-388 from BBOX1 (NP_003977) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6H3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Catalyzes the formation of L-carnitine from gamma-butyrobetaine. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: IELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.