123843-BIOTIN

BAZ1A (Bromodomain Adjacent to Zinc Finger Domain Protein 1A, ATP-dependent Chromatin-remodeling Protein, ATP-utilizing Chromatin Assembly and Remodeling Factor 1, hACF1, CHRAC Subunit ACF1, Williams Syndrome Transcription Factor-related Chromatin-remodeling Factor 180, WCRF180, hWALp1, ACF1, WCRF180, HSPC317, DKFZp586E0518, FLJ14383) (Biotin)

Größe

£927.00

SKU:: 123843-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1457-1557 from BAZ1A (NP_038476) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Component of the ACF complex, an ATP-dependent chromatin remodeling complex, that regulates spacing of nucleosomes using ATP to generate evenly spaced nucleosomes along the chromatin. The ATPase activity of the complex is regulated by the length of flanking DNA. Also involved in facilitating the DNA replication process. BAZ1A is the accessory, non-catalytic subunit of the complex which can enhance and direct the process provided by the ATPase subunit, SMARCA5, probably through targeting pericentromeric heterochromatin in late S phase. Moves end-positioned nucleosomes to a predominantly central position. May have a role in nuclear receptor-mediated transcription repression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Seqeuence: LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice