123805-FITC
BAG1 (BAG Family Molecular Chaperone Regulator 1, BAG-1, BCL-2 Associated Athanogene 1, BCL-2-associated Athanogene 1, BCL2-associated Athanogene, RAP46) (FITC)
Größe
£914.00
- SKU:
- 123805-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- Bcl-2-associated athanogene 1 (BAG-1) was first identified as an anti-apoptotic bcl-2-binding protein. Later it was found to bind the molecular chaperones Hsp70 and Hsc70 through its C-terminal sequence (termed the Bag domain), resulting in the inhibition of the refolding activity of these chaperones. It is thought that by binding and inhibiting these molecular chaperones, BAG-1 is able to modulate the expression level of proteins requiring chaperones to fold correctly. One such group of proteins that are affected is glucocorticoid receptors. Other reports have suggested that the level of BAG-1 expression correlates with the aggressiveness of various cancers. Multiple isoforms of BAG-1 are known to exist. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 35ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice