123803-ML550
BAFF Receptor (BAFFR, BAFF-R, B Cell-activating Factor Receptor, BLyS Receptor 3, BR3, BROMIX, CD268, CVID4, MGC138235, Prolixin, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C) (MaxLight 550)
Größe
£934.00
- SKU:
- 123803-ML550
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length protein corresponding to aa 1-184 from human BAFF Receptor.
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. B cell-activating factor receptor (BAFF-R) is a 19kD type III membrane protein. It belongs to the TNFR superfamily also known as TNFRSF member 13C (TNFRSF13C), BAFF receptor 3 (BR3), or CD268. BAFF-R is expressed on mature B cells, B cell lymphoma, and T cell subset. BAFF-R is the major receptor for BAFF/BLys (or TALL-1, THANK), which binds to TACI and BCMA as well. The interaction of BAFF with BAFF-R promotes NF-k B activation and plays a major role in B-cell maturation and survival, as well as costimulates T cell activation and proliferation. TRAF3 is a BAFF-R intracellularly associated protein, which negatively regulates BAFF-R-mediated NF-k B activation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice