123797-BIOTIN
BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (Biotin)
Größe
£927.00
- SKU:
- 123797-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa396-492 from human BACH1 (NP_996749) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- ubiquitously expressed member of the Bach family of transcription factors. Although its predicted MW is 82kD, it runs anomalously at 110kD in SDS-PAGE. BACH1 forms noncovalent homodimers, and heterodimers with Maf oncoproteins and p53-related proteins. It apparently serves as an architectural component for gene regulatory protein complexes. Human BACH1 is 736 aa in length. It contains a protein-interaction BTB domain (aa 24-127), a DNA-binding motif (aa 562-577), and a Leu-zipper domain (aa 585-607). This molecule should not be confused with Bach1/Fancj/Brip1 helicase. There are two BACH1 splice variants with a 24 and 31aa substitution for aa593-736, respectively. Over aa 133-513, human BACH1 shares 75% aa identity with mouse BACH1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice